Class a: All alpha proteins [46456] (202 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.10: N-terminal Zn binding domain of HIV integrase [46919] (1 family) |
Family a.4.10.1: N-terminal Zn binding domain of HIV integrase [46920] (1 protein) Zn-binding site is near the C-terminus |
Protein N-terminal Zn binding domain of HIV integrase [46921] (2 species) |
Species Human immunodeficiency virus type 1 [TaxId:11676] [46922] (7 PDB entries) |
Domain d1k6yd1: 1k6y D:1-46 [68245] Other proteins in same PDB: d1k6ya2, d1k6yb2, d1k6yc2, d1k6yd2 complexed with k, po4, zn; mutant |
PDB Entry: 1k6y (more details), 2.4 Å
SCOP Domain Sequences for d1k6yd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k6yd1 a.4.10.1 (D:1-46) N-terminal Zn binding domain of HIV integrase {Human immunodeficiency virus type 1} fldgidkaqeehekyhsnwramasdfnlppvvakeivascdkcqlk
Timeline for d1k6yd1: