Lineage for d1jz6a1 (1jz6 A:220-333)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) 
Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins) 
Protein beta-Galactosidase, domains 2 and 4 [49305] (3 species) Species Escherichia coli [TaxId:562] [49306] (45 PDB entries)
Uniprot P00722
Domain d1jz6a1: 1jz6 A:220-333 [67790]
Other proteins in same PDB: d1jz6a3, d1jz6a4, d1jz6a5, d1jz6b3, d1jz6b4, d1jz6b5, d1jz6c3, d1jz6c4, d1jz6c5, d1jz6d3, d1jz6d4, d1jz6d5
complexed with dms, gtz, mg, na
Details for d1jz6a1
PDB Entry: 1jz6 (more details), 2.1 Å
PDB Description: e. coli (lacz) beta-galactosidase in complex with galacto-tetrazole
PDB Compounds: (A:) beta-galactosidaseSCOPe Domain Sequences for d1jz6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jz6a1 b.1.4.1 (A:220-333) beta-Galactosidase, domains 2 and 4 {Escherichia coli [TaxId: 562]}
tqisdfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeii
derggyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfr
SCOPe Domain Coordinates for d1jz6a1:
Click to download the PDB-style file with coordinates for d1jz6a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jz6a1:
- d1jz6a1 first appeared in SCOP 1.59
- d1jz6a1 appears in SCOPe 2.06
- d1jz6a1 appears in the current release, SCOPe 2.08
 View in 3DDomains from same chain: (mouse over for more information) d1jz6a2, d1jz6a3, d1jz6a4, d1jz6a5 |
