Lineage for d1jz6b4 (1jz6 B:731-1023)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2391115Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2391261Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 2391262Family b.30.5.1: beta-Galactosidase, domain 5 [49995] (1 protein)
    automatically mapped to Pfam PF02929
  6. 2391263Protein beta-Galactosidase, domain 5 [49996] (3 species)
  7. 2391271Species Escherichia coli [TaxId:562] [49997] (45 PDB entries)
    Uniprot P00722
  8. 2391341Domain d1jz6b4: 1jz6 B:731-1023 [67798]
    Other proteins in same PDB: d1jz6a1, d1jz6a2, d1jz6a3, d1jz6a5, d1jz6b1, d1jz6b2, d1jz6b3, d1jz6b5, d1jz6c1, d1jz6c2, d1jz6c3, d1jz6c5, d1jz6d1, d1jz6d2, d1jz6d3, d1jz6d5
    complexed with dms, gtz, mg, na

Details for d1jz6b4

PDB Entry: 1jz6 (more details), 2.1 Å

PDB Description: e. coli (lacz) beta-galactosidase in complex with galacto-tetrazole
PDB Compounds: (B:) beta-galactosidase

SCOPe Domain Sequences for d1jz6b4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jz6b4 b.30.5.1 (B:731-1023) beta-Galactosidase, domain 5 {Escherichia coli [TaxId: 562]}
paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld
ndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf
isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl
taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet
shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk

SCOPe Domain Coordinates for d1jz6b4:

Click to download the PDB-style file with coordinates for d1jz6b4.
(The format of our PDB-style files is described here.)

Timeline for d1jz6b4: