Lineage for d1jz6c1 (1jz6 C:220-333)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2372434Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) (S)
  5. 2372435Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins)
  6. 2372436Protein beta-Galactosidase, domains 2 and 4 [49305] (3 species)
  7. 2372450Species Escherichia coli [TaxId:562] [49306] (45 PDB entries)
    Uniprot P00722
  8. 2372591Domain d1jz6c1: 1jz6 C:220-333 [67800]
    Other proteins in same PDB: d1jz6a3, d1jz6a4, d1jz6a5, d1jz6b3, d1jz6b4, d1jz6b5, d1jz6c3, d1jz6c4, d1jz6c5, d1jz6d3, d1jz6d4, d1jz6d5
    complexed with dms, gtz, mg, na

Details for d1jz6c1

PDB Entry: 1jz6 (more details), 2.1 Å

PDB Description: e. coli (lacz) beta-galactosidase in complex with galacto-tetrazole
PDB Compounds: (C:) beta-galactosidase

SCOPe Domain Sequences for d1jz6c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jz6c1 b.1.4.1 (C:220-333) beta-Galactosidase, domains 2 and 4 {Escherichia coli [TaxId: 562]}
tqisdfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeii
derggyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfr

SCOPe Domain Coordinates for d1jz6c1:

Click to download the PDB-style file with coordinates for d1jz6c1.
(The format of our PDB-style files is described here.)

Timeline for d1jz6c1: