SCOPe 2.08: Domain d1jz1n1: 1jz1 N:220-333

Lineage for d1jz1n1 (1jz1 N:220-333)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families)

5. Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins)

6. Protein beta-Galactosidase, domains 2 and 4 [49305] (3 species)

7. Species Escherichia coli [TaxId:562] [49306] (46 PDB entries)
   Uniprot P00722

8. Domain d1jz1n1: 1jz1 N:220-333 [67695]
   Other proteins in same PDB: d1jz1i3, d1jz1i4, d1jz1i5, d1jz1j3, d1jz1j4, d1jz1j5, d1jz1k3, d1jz1k4, d1jz1k5, d1jz1l3, d1jz1l4, d1jz1l5, d1jz1m3, d1jz1m4, d1jz1m5, d1jz1n3, d1jz1n4, d1jz1n5, d1jz1o3, d1jz1o4, d1jz1o5, d1jz1p3, d1jz1p4, d1jz1p5
   complexed with 2fg, mg, na
   complexed with 2fg, mg, na

Details for d1jz1n1

PDB Entry: 1jz1, 2.6 Å

PDB Description: e. coli (lacz) beta-galactosidase-trapped 2-f-galactosyl-enzyme intermediate. chains i-p, see remark 400

PDB Compounds: (N:) beta-galactosidase

SCOPe Domain Sequences for d1jz1n1:

Sequence; same for both SEQRES and ATOM records:

>d1jz1n1 b.1.4.1 (N:220-333) beta-Galactosidase, domains 2 and 4 {Escherichia coli [TaxId: 562]}
tqisdfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeii
derggyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfr

Timeline for d1jz1n1:

• d1jz1n1 first appeared in SCOP 1.59
  
• d1jz1n1 appears in SCOPe 2.07