![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) ![]() |
![]() | Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins) |
![]() | Protein beta-Galactosidase, domains 2 and 4 [49305] (3 species) |
![]() | Species Escherichia coli [TaxId:562] [49306] (46 PDB entries) Uniprot P00722 |
![]() | Domain d1jz1l1: 1jz1 L:220-333 [67685] Other proteins in same PDB: d1jz1i3, d1jz1i4, d1jz1i5, d1jz1j3, d1jz1j4, d1jz1j5, d1jz1k3, d1jz1k4, d1jz1k5, d1jz1l3, d1jz1l4, d1jz1l5, d1jz1m3, d1jz1m4, d1jz1m5, d1jz1n3, d1jz1n4, d1jz1n5, d1jz1o3, d1jz1o4, d1jz1o5, d1jz1p3, d1jz1p4, d1jz1p5 complexed with 2fg, mg, na complexed with 2fg, mg, na |
PDB Entry: 1jz1 (more details), 2.6 Å
SCOPe Domain Sequences for d1jz1l1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jz1l1 b.1.4.1 (L:220-333) beta-Galactosidase, domains 2 and 4 {Escherichia coli [TaxId: 562]} tqisdfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeii derggyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfr
Timeline for d1jz1l1:
![]() Domains from same chain: (mouse over for more information) d1jz1l2, d1jz1l3, d1jz1l4, d1jz1l5 |
![]() Domains from other chains: (mouse over for more information) d1jz1i1, d1jz1i2, d1jz1i3, d1jz1i4, d1jz1i5, d1jz1j1, d1jz1j2, d1jz1j3, d1jz1j4, d1jz1j5, d1jz1k1, d1jz1k2, d1jz1k3, d1jz1k4, d1jz1k5, d1jz1m1, d1jz1m2, d1jz1m3, d1jz1m4, d1jz1m5, d1jz1n1, d1jz1n2, d1jz1n3, d1jz1n4, d1jz1n5, d1jz1o1, d1jz1o2, d1jz1o3, d1jz1o4, d1jz1o5, d1jz1p1, d1jz1p2, d1jz1p3, d1jz1p4, d1jz1p5 |