![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.30: Supersandwich [49993] (3 superfamilies) sandwich; 18 strands in 2 sheets |
![]() | Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) ![]() probable carbohydrate-binding domain in enzymes acting on sugars |
![]() | Family b.30.5.1: beta-Galactosidase, domain 5 [49995] (1 protein) automatically mapped to Pfam PF02929 |
![]() | Protein beta-Galactosidase, domain 5 [49996] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [49997] (46 PDB entries) Uniprot P00722 |
![]() | Domain d1jz1p4: 1jz1 P:731-1023 [67708] Other proteins in same PDB: d1jz1i1, d1jz1i2, d1jz1i3, d1jz1i5, d1jz1j1, d1jz1j2, d1jz1j3, d1jz1j5, d1jz1k1, d1jz1k2, d1jz1k3, d1jz1k5, d1jz1l1, d1jz1l2, d1jz1l3, d1jz1l5, d1jz1m1, d1jz1m2, d1jz1m3, d1jz1m5, d1jz1n1, d1jz1n2, d1jz1n3, d1jz1n5, d1jz1o1, d1jz1o2, d1jz1o3, d1jz1o5, d1jz1p1, d1jz1p2, d1jz1p3, d1jz1p5 complexed with 2fg, mg, na complexed with 2fg, mg, na |
PDB Entry: 1jz1 (more details), 2.6 Å
SCOPe Domain Sequences for d1jz1p4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jz1p4 b.30.5.1 (P:731-1023) beta-Galactosidase, domain 5 {Escherichia coli [TaxId: 562]} paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld ndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk
Timeline for d1jz1p4:
![]() Domains from same chain: (mouse over for more information) d1jz1p1, d1jz1p2, d1jz1p3, d1jz1p5 |
![]() Domains from other chains: (mouse over for more information) d1jz1i1, d1jz1i2, d1jz1i3, d1jz1i4, d1jz1i5, d1jz1j1, d1jz1j2, d1jz1j3, d1jz1j4, d1jz1j5, d1jz1k1, d1jz1k2, d1jz1k3, d1jz1k4, d1jz1k5, d1jz1l1, d1jz1l2, d1jz1l3, d1jz1l4, d1jz1l5, d1jz1m1, d1jz1m2, d1jz1m3, d1jz1m4, d1jz1m5, d1jz1n1, d1jz1n2, d1jz1n3, d1jz1n4, d1jz1n5, d1jz1o1, d1jz1o2, d1jz1o3, d1jz1o4, d1jz1o5 |