![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) ![]() |
![]() | Family c.1.8.3: beta-glycanases [51487] (27 proteins) consist of a number of sequence families |
![]() | Protein beta-Galactosidase, domain 3 [51510] (3 species) |
![]() | Species Escherichia coli [TaxId:562] [51511] (46 PDB entries) Uniprot P00722 |
![]() | Domain d1jz1n5: 1jz1 N:334-625 [67699] Other proteins in same PDB: d1jz1i1, d1jz1i2, d1jz1i3, d1jz1i4, d1jz1j1, d1jz1j2, d1jz1j3, d1jz1j4, d1jz1k1, d1jz1k2, d1jz1k3, d1jz1k4, d1jz1l1, d1jz1l2, d1jz1l3, d1jz1l4, d1jz1m1, d1jz1m2, d1jz1m3, d1jz1m4, d1jz1n1, d1jz1n2, d1jz1n3, d1jz1n4, d1jz1o1, d1jz1o2, d1jz1o3, d1jz1o4, d1jz1p1, d1jz1p2, d1jz1p3, d1jz1p4 complexed with 2fg, mg, na complexed with 2fg, mg, na |
PDB Entry: 1jz1 (more details), 2.6 Å
SCOPe Domain Sequences for d1jz1n5:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jz1n5 c.1.8.3 (N:334-625) beta-Galactosidase, domain 3 {Escherichia coli [TaxId: 562]} evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq
Timeline for d1jz1n5:
![]() Domains from same chain: (mouse over for more information) d1jz1n1, d1jz1n2, d1jz1n3, d1jz1n4 |
![]() Domains from other chains: (mouse over for more information) d1jz1i1, d1jz1i2, d1jz1i3, d1jz1i4, d1jz1i5, d1jz1j1, d1jz1j2, d1jz1j3, d1jz1j4, d1jz1j5, d1jz1k1, d1jz1k2, d1jz1k3, d1jz1k4, d1jz1k5, d1jz1l1, d1jz1l2, d1jz1l3, d1jz1l4, d1jz1l5, d1jz1m1, d1jz1m2, d1jz1m3, d1jz1m4, d1jz1m5, d1jz1o1, d1jz1o2, d1jz1o3, d1jz1o4, d1jz1o5, d1jz1p1, d1jz1p2, d1jz1p3, d1jz1p4, d1jz1p5 |