Lineage for d1jz1l5 (1jz1 L:334-625)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 235645Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 236226Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) (S)
  5. 236477Family c.1.8.3: beta-glycanases [51487] (14 proteins)
    consist of a number of sequence families
  6. 236482Protein beta-Galactosidase, domain 3 [51510] (1 species)
  7. 236483Species Escherichia coli [TaxId:562] [51511] (23 PDB entries)
  8. 236579Domain d1jz1l5: 1jz1 L:334-625 [67689]
    Other proteins in same PDB: d1jz1i1, d1jz1i2, d1jz1i3, d1jz1i4, d1jz1j1, d1jz1j2, d1jz1j3, d1jz1j4, d1jz1k1, d1jz1k2, d1jz1k3, d1jz1k4, d1jz1l1, d1jz1l2, d1jz1l3, d1jz1l4, d1jz1m1, d1jz1m2, d1jz1m3, d1jz1m4, d1jz1n1, d1jz1n2, d1jz1n3, d1jz1n4, d1jz1o1, d1jz1o2, d1jz1o3, d1jz1o4, d1jz1p1, d1jz1p2, d1jz1p3, d1jz1p4

Details for d1jz1l5

PDB Entry: 1jz1 (more details), 2.6 Å

PDB Description: e. coli (lacz) beta-galactosidase-trapped 2-f-galactosyl-enzyme intermediate. chains i-p, see remark 400

SCOP Domain Sequences for d1jz1l5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jz1l5 c.1.8.3 (L:334-625) beta-Galactosidase, domain 3 {Escherichia coli}
evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp
nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv
iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp
avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq
slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq

SCOP Domain Coordinates for d1jz1l5:

Click to download the PDB-style file with coordinates for d1jz1l5.
(The format of our PDB-style files is described here.)

Timeline for d1jz1l5: