![]() | Class b: All beta proteins [48724] (119 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (1 family) ![]() |
![]() | Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (2 proteins) |
![]() | Protein beta-Galactosidase, domains 2 and 4 [49305] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [49306] (23 PDB entries) |
![]() | Domain d1jz1m2: 1jz1 M:626-730 [67691] Other proteins in same PDB: d1jz1i3, d1jz1i4, d1jz1i5, d1jz1j3, d1jz1j4, d1jz1j5, d1jz1k3, d1jz1k4, d1jz1k5, d1jz1l3, d1jz1l4, d1jz1l5, d1jz1m3, d1jz1m4, d1jz1m5, d1jz1n3, d1jz1n4, d1jz1n5, d1jz1o3, d1jz1o4, d1jz1o5, d1jz1p3, d1jz1p4, d1jz1p5 |
PDB Entry: 1jz1 (more details), 2.6 Å
SCOP Domain Sequences for d1jz1m2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jz1m2 b.1.4.1 (M:626-730) beta-Galactosidase, domains 2 and 4 {Escherichia coli} ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl
Timeline for d1jz1m2:
![]() Domains from same chain: (mouse over for more information) d1jz1m1, d1jz1m3, d1jz1m4, d1jz1m5 |
![]() Domains from other chains: (mouse over for more information) d1jz1i1, d1jz1i2, d1jz1i3, d1jz1i4, d1jz1i5, d1jz1j1, d1jz1j2, d1jz1j3, d1jz1j4, d1jz1j5, d1jz1k1, d1jz1k2, d1jz1k3, d1jz1k4, d1jz1k5, d1jz1l1, d1jz1l2, d1jz1l3, d1jz1l4, d1jz1l5, d1jz1n1, d1jz1n2, d1jz1n3, d1jz1n4, d1jz1n5, d1jz1o1, d1jz1o2, d1jz1o3, d1jz1o4, d1jz1o5, d1jz1p1, d1jz1p2, d1jz1p3, d1jz1p4, d1jz1p5 |