SCOP 1.63: Domain d1jz1j2: 1jz1 J:626-730

Lineage for d1jz1j2 (1jz1 J:626-730)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (1 family)

5. Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (2 proteins)

6. Protein beta-Galactosidase, domains 2 and 4 [49305] (1 species)

7. Species Escherichia coli [TaxId:562] [49306] (23 PDB entries)

8. Domain d1jz1j2: 1jz1 J:626-730 [67676]
   Other proteins in same PDB: d1jz1i3, d1jz1i4, d1jz1i5, d1jz1j3, d1jz1j4, d1jz1j5, d1jz1k3, d1jz1k4, d1jz1k5, d1jz1l3, d1jz1l4, d1jz1l5, d1jz1m3, d1jz1m4, d1jz1m5, d1jz1n3, d1jz1n4, d1jz1n5, d1jz1o3, d1jz1o4, d1jz1o5, d1jz1p3, d1jz1p4, d1jz1p5

Details for d1jz1j2

PDB Entry: 1jz1, 2.6 Å

PDB Description: e. coli (lacz) beta-galactosidase-trapped 2-f-galactosyl-enzyme intermediate. chains i-p, see remark 400

SCOP Domain Sequences for d1jz1j2:

Sequence; same for both SEQRES and ATOM records:

>d1jz1j2 b.1.4.1 (J:626-730) beta-Galactosidase, domains 2 and 4 {Escherichia coli}
ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel
pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl

Timeline for d1jz1j2:

• d1jz1j2 first appeared in SCOP 1.59
  
• d1jz1j2 appears in SCOP 1.61
  
• d1jz1j2 appears in SCOP 1.65
  
• d1jz1j2 appears in the current release, SCOPe 2.08