| Class b: All beta proteins [48724] (110 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies) |
Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (1 family) ![]() |
| Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (2 proteins) |
| Protein beta-Galactosidase, domains 2 and 4 [49305] (1 species) |
| Species Escherichia coli [TaxId:562] [49306] (23 PDB entries) |
| Domain d1jyxc1: 1jyx C:220-333 [67540] Other proteins in same PDB: d1jyxa3, d1jyxa4, d1jyxa5, d1jyxb3, d1jyxb4, d1jyxb5, d1jyxc3, d1jyxc4, d1jyxc5, d1jyxd3, d1jyxd4, d1jyxd5 |
PDB Entry: 1jyx (more details), 1.75 Å
SCOP Domain Sequences for d1jyxc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jyxc1 b.1.4.1 (C:220-333) beta-Galactosidase, domains 2 and 4 {Escherichia coli}
tqisdfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeii
derggyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfr
Timeline for d1jyxc1:
View in 3DDomains from same chain: (mouse over for more information) d1jyxc2, d1jyxc3, d1jyxc4, d1jyxc5 |