![]() | Class b: All beta proteins [48724] (110 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies) |
![]() | Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (1 family) ![]() |
![]() | Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (2 proteins) |
![]() | Protein beta-Galactosidase, domains 2 and 4 [49305] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [49306] (23 PDB entries) |
![]() | Domain d1jyxb1: 1jyx B:220-333 [67535] Other proteins in same PDB: d1jyxa3, d1jyxa4, d1jyxa5, d1jyxb3, d1jyxb4, d1jyxb5, d1jyxc3, d1jyxc4, d1jyxc5, d1jyxd3, d1jyxd4, d1jyxd5 |
PDB Entry: 1jyx (more details), 1.75 Å
SCOP Domain Sequences for d1jyxb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jyxb1 b.1.4.1 (B:220-333) beta-Galactosidase, domains 2 and 4 {Escherichia coli} tqisdfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeii derggyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfr
Timeline for d1jyxb1:
![]() Domains from same chain: (mouse over for more information) d1jyxb2, d1jyxb3, d1jyxb4, d1jyxb5 |