Lineage for d1jyxc3 (1jyx C:13-219)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 107983Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
  4. 107984Superfamily b.18.1: Galactose-binding domain-like [49785] (13 families) (S)
  5. 108022Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (2 proteins)
  6. 108023Protein beta-Galactosidase [49804] (1 species)
  7. 108024Species Escherichia coli [TaxId:562] [49805] (23 PDB entries)
  8. 108051Domain d1jyxc3: 1jyx C:13-219 [67542]
    Other proteins in same PDB: d1jyxa1, d1jyxa2, d1jyxa4, d1jyxa5, d1jyxb1, d1jyxb2, d1jyxb4, d1jyxb5, d1jyxc1, d1jyxc2, d1jyxc4, d1jyxc5, d1jyxd1, d1jyxd2, d1jyxd4, d1jyxd5

Details for d1jyxc3

PDB Entry: 1jyx (more details), 1.75 Å

PDB Description: e. coli (lacz) beta-galactosidase in complex with iptg

SCOP Domain Sequences for d1jyxc3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jyxc3 b.18.1.5 (C:13-219) beta-Galactosidase {Escherichia coli}
rrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapeavpes
wlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfnvdes
wlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmvlrws
dgsyledqdmwrmsgifrdvsllhkpt

SCOP Domain Coordinates for d1jyxc3:

Click to download the PDB-style file with coordinates for d1jyxc3.
(The format of our PDB-style files is described here.)

Timeline for d1jyxc3: