Lineage for d1jxzb_ (1jxz B:)
- Root: SCOP 1.59
Class c: Alpha and beta proteins (a/b) [51349] (113 folds) 
Fold c.14: ClpP/crotonase [52095] (1 superfamily) Superfamily c.14.1: ClpP/crotonase [52096] (3 families) 
Family c.14.1.3: Crotonase-like [52103] (5 proteins) 
Protein 4-Chlorobenzoyl-CoA dehalogenase [52104] (1 species) Species Pseudomonas sp., strain CBS-3 [TaxId:306] [52105] (2 PDB entries) 
Domain d1jxzb_: 1jxz B: [67436]
Details for d1jxzb_
PDB Entry: 1jxz (more details), 1.9 Å
PDB Description: structure of the h90q mutant of 4-chlorobenzoyl-coenzyme a dehalogenase complexed with 4-hydroxybenzoyl-coenzyme a (product)
SCOP Domain Sequences for d1jxzb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jxzb_ c.14.1.3 (B:) 4-Chlorobenzoyl-CoA dehalogenase {Pseudomonas sp., strain CBS-3}
myeaighrvedgvaeitiklprhrnalsvkamqevtdalnraeeddsvgavmitgaedaf
cagfylreipldkgvagvrdhfriaalwwqqmihkiirvkrpvlaaingvaaggglgisl
asdmaicadsakfvcawhtigigndtatsyslarivgmrramelmltnrtlypeeakdwg
lvsrvypkdefrevawkvarelaaapthlqvmakerfhagwmqpveectefeiqnviasv
thphfmpcltrfldghradrpqvelpagv
SCOP Domain Coordinates for d1jxzb_:
Click to download the PDB-style file with coordinates for d1jxzb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jxzb_:
- d1jxzb_ is new in SCOP 1.59
- d1jxzb_ appears in SCOP 1.61
- d1jxzb_ appears in the current release, SCOPe 2.08
View in 3D
