Lineage for d1jxzb_ (1jxz B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2852293Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2852294Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2853061Family c.14.1.3: Crotonase-like [52103] (14 proteins)
  6. 2853062Protein 4-Chlorobenzoyl-CoA dehalogenase [52104] (1 species)
  7. 2853063Species Pseudomonas sp., strain CBS-3 [TaxId:306] [52105] (2 PDB entries)
  8. 2853068Domain d1jxzb_: 1jxz B: [67436]
    complexed with bca, ca, po4; mutant

Details for d1jxzb_

PDB Entry: 1jxz (more details), 1.9 Å

PDB Description: structure of the h90q mutant of 4-chlorobenzoyl-coenzyme a dehalogenase complexed with 4-hydroxybenzoyl-coenzyme a (product)
PDB Compounds: (B:) 4-chlorobenzoyl Coenzyme A dehalogenase

SCOPe Domain Sequences for d1jxzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jxzb_ c.14.1.3 (B:) 4-Chlorobenzoyl-CoA dehalogenase {Pseudomonas sp., strain CBS-3 [TaxId: 306]}
myeaighrvedgvaeitiklprhrnalsvkamqevtdalnraeeddsvgavmitgaedaf
cagfylreipldkgvagvrdhfriaalwwqqmihkiirvkrpvlaaingvaaggglgisl
asdmaicadsakfvcawhtigigndtatsyslarivgmrramelmltnrtlypeeakdwg
lvsrvypkdefrevawkvarelaaapthlqvmakerfhagwmqpveectefeiqnviasv
thphfmpcltrfldghradrpqvelpagv

SCOPe Domain Coordinates for d1jxzb_:

Click to download the PDB-style file with coordinates for d1jxzb_.
(The format of our PDB-style files is described here.)

Timeline for d1jxzb_: