Lineage for d1jxzc_ (1jxz C:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 119892Fold c.14: ClpP/crotonase [52095] (1 superfamily)
  4. 119893Superfamily c.14.1: ClpP/crotonase [52096] (3 families) (S)
  5. 119929Family c.14.1.3: Crotonase-like [52103] (5 proteins)
  6. 119930Protein 4-Chlorobenzoyl-CoA dehalogenase [52104] (1 species)
  7. 119931Species Pseudomonas sp., strain CBS-3 [TaxId:306] [52105] (2 PDB entries)
  8. 119937Domain d1jxzc_: 1jxz C: [67437]

Details for d1jxzc_

PDB Entry: 1jxz (more details), 1.9 Å

PDB Description: structure of the h90q mutant of 4-chlorobenzoyl-coenzyme a dehalogenase complexed with 4-hydroxybenzoyl-coenzyme a (product)

SCOP Domain Sequences for d1jxzc_:

Sequence, based on SEQRES records: (download)

>d1jxzc_ c.14.1.3 (C:) 4-Chlorobenzoyl-CoA dehalogenase {Pseudomonas sp., strain CBS-3}
myeaighrvedgvaeitiklprhrnalsvkamqevtdalnraeeddsvgavmitgaedaf
cagfylreipldkgvagvrdhfriaalwwqqmihkiirvkrpvlaaingvaaggglgisl
asdmaicadsakfvcawhtigigndtatsyslarivgmrramelmltnrtlypeeakdwg
lvsrvypkdefrevawkvarelaaapthlqvmakerfhagwmqpveectefeiqnviasv
thphfmpcltrfldghradrpqvelpagv

Sequence, based on observed residues (ATOM records): (download)

>d1jxzc_ c.14.1.3 (C:) 4-Chlorobenzoyl-CoA dehalogenase {Pseudomonas sp., strain CBS-3}
myeaighrvedgvaeitiklprhrnalsvkamqevtdalnraeeddsvgavmitgaedaf
cagfylreipldkgvagvrdhfriaalwwqqmihkiirvkrpvlaaingvaaggglgisl
asdmaicadsakfvcawhtigigndtatsyslarivgmrramelmltnrtlypeeakdwg
lvsrvypkdefrevawkvarelaaapthlqvmakerfhagwmqpveectefeiqnviasv
thphfmpcltrfldgpqvelpagv

SCOP Domain Coordinates for d1jxzc_:

Click to download the PDB-style file with coordinates for d1jxzc_.
(The format of our PDB-style files is described here.)

Timeline for d1jxzc_: