Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.80: SIS domain [53696] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345 |
Superfamily c.80.1: SIS domain [53697] (3 families) |
Family c.80.1.1: double-SIS domain [53698] (4 proteins) duplication: consists of two SIS domains related by pseudo dyad |
Protein "Isomerase domain" of glucosamine 6-phosphate synthase (GLMS) [53699] (1 species) |
Species Escherichia coli [TaxId:562] [53700] (6 PDB entries) |
Domain d1jxab1: 1jxa B:241-608 [67409] Other proteins in same PDB: d1jxaa2, d1jxab2, d1jxac2 |
PDB Entry: 1jxa (more details), 3.1 Å
SCOP Domain Sequences for d1jxab1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jxab1 c.80.1.1 (B:241-608) "Isomerase domain" of glucosamine 6-phosphate synthase (GLMS) {Escherichia coli [TaxId: 562]} dagdkgiyrhymqkeiyeqpnaikntltgrishgqvdlselgpnadellskvehiqilac gtsynsgmvsrywfeslagipcdveiasefryrksavrrnslmitlsqsgetadtlaglr lskelgylgslaicnvpgsslvresdlalmtnagteigvastkafttqltvllmlvakls klkgldasiehdivhglqalpsrieqmlsqdkriealaedfsdkhhalflgrgdqypial egalklkeisyihaeayaagelkhgplalidadmpvivvapnnelleklksnieevrarg gqlyvfadqdagfvssdnmhiiemphveeviapifytvplqllayhvalikgtdvdqprn laksvtve
Timeline for d1jxab1:
View in 3D Domains from other chains: (mouse over for more information) d1jxaa1, d1jxaa2, d1jxac1, d1jxac2 |