Lineage for d1jxab2 (1jxa B:1-240)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 735798Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 735799Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (6 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 735800Family d.153.1.1: Class II glutamine amidotransferases [56236] (6 proteins)
    has slightly different topology than other families do
  6. 735840Protein Glucosamine 6-phosphate synthase, N-terminal domain [56237] (1 species)
  7. 735841Species Escherichia coli [TaxId:562] [56238] (5 PDB entries)
  8. 735852Domain d1jxab2: 1jxa B:1-240 [67410]
    Other proteins in same PDB: d1jxaa1, d1jxab1, d1jxac1

Details for d1jxab2

PDB Entry: 1jxa (more details), 3.1 Å

PDB Description: glucosamine 6-phosphate synthase with glucose 6-phosphate
PDB Compounds: (B:) glucosamine 6-phosphate synthase

SCOP Domain Sequences for d1jxab2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jxab2 d.153.1.1 (B:1-240) Glucosamine 6-phosphate synthase, N-terminal domain {Escherichia coli [TaxId: 562]}
cgivgaiaqrdvaeilleglrrleyrgydsaglavvdaeghmtrlrrlgkvqmlaqaaee
hplhggtgiahtrwathgepsevnahphvsehivvvhngiienheplreelkargytfvs
etdteviahlvnwelkqggtlreavlraipqlrgaygtvimdsrhpdtllaarsgsplvi
glgmgenfiasdqlallpvtrrfifleegdiaeitrrsvnifdktgaevkrqdiesnlqy

SCOP Domain Coordinates for d1jxab2:

Click to download the PDB-style file with coordinates for d1jxab2.
(The format of our PDB-style files is described here.)

Timeline for d1jxab2: