Lineage for d1jxab1 (1jxa B:241-608)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 592149Fold c.80: SIS domain [53696] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345
  4. 592150Superfamily c.80.1: SIS domain [53697] (3 families) (S)
  5. 592151Family c.80.1.1: double-SIS domain [53698] (4 proteins)
    duplication: consists of two SIS domains related by pseudo dyad
  6. 592152Protein "Isomerase domain" of glucosamine 6-phosphate synthase (GLMS) [53699] (1 species)
  7. 592153Species Escherichia coli [TaxId:562] [53700] (4 PDB entries)
  8. 592158Domain d1jxab1: 1jxa B:241-608 [67409]
    Other proteins in same PDB: d1jxaa2, d1jxab2, d1jxac2

Details for d1jxab1

PDB Entry: 1jxa (more details), 3.1 Å

PDB Description: glucosamine 6-phosphate synthase with glucose 6-phosphate

SCOP Domain Sequences for d1jxab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jxab1 c.80.1.1 (B:241-608) "Isomerase domain" of glucosamine 6-phosphate synthase (GLMS) {Escherichia coli}
dagdkgiyrhymqkeiyeqpnaikntltgrishgqvdlselgpnadellskvehiqilac
gtsynsgmvsrywfeslagipcdveiasefryrksavrrnslmitlsqsgetadtlaglr
lskelgylgslaicnvpgsslvresdlalmtnagteigvastkafttqltvllmlvakls
klkgldasiehdivhglqalpsrieqmlsqdkriealaedfsdkhhalflgrgdqypial
egalklkeisyihaeayaagelkhgplalidadmpvivvapnnelleklksnieevrarg
gqlyvfadqdagfvssdnmhiiemphveeviapifytvplqllayhvalikgtdvdqprn
laksvtve

SCOP Domain Coordinates for d1jxab1:

Click to download the PDB-style file with coordinates for d1jxab1.
(The format of our PDB-style files is described here.)

Timeline for d1jxab1: