PDB entry 1jxa

View 1jxa on RCSB PDB site
Description: glucosamine 6-phosphate synthase with glucose 6-phosphate
Class: transferase
Keywords: beta-sandwich, nucleotide-binding fold, gene duplication, ammonia channel
Deposited on 2001-09-06, released 2001-11-21
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.22
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glucosamine 6-phosphate synthase
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17169 (0-607)
      • conflict (420)
    Domains in SCOP 1.73: d1jxaa1, d1jxaa2
  • Chain 'B':
    Compound: glucosamine 6-phosphate synthase
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17169 (0-607)
      • conflict (420)
    Domains in SCOP 1.73: d1jxab1, d1jxab2
  • Chain 'C':
    Compound: glucosamine 6-phosphate synthase
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17169 (0-607)
      • conflict (420)
    Domains in SCOP 1.73: d1jxac1, d1jxac2
  • Heterogens: G6Q, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jxaA (A:)
    cgivgaiaqrdvaeilleglrrleyrgydsaglavvdaeghmtrlrrlgkvqmlaqaaee
    hplhggtgiahtrwathgepsevnahphvsehivvvhngiienheplreelkargytfvs
    etdteviahlvnwelkqggtlreavlraipqlrgaygtvimdsrhpdtllaarsgsplvi
    glgmgenfiasdqlallpvtrrfifleegdiaeitrrsvnifdktgaevkrqdiesnlqy
    dagdkgiyrhymqkeiyeqpnaikntltgrishgqvdlselgpnadellskvehiqilac
    gtsynsgmvsrywfeslagipcdveiasefryrksavrrnslmitlsqsgetadtlaglr
    lskelgylgslaicnvpgsslvresdlalmtnagteigvastkafttqltvllmlvakls
    klkgldasiehdivhglqalpsrieqmlsqdkriealaedfsdkhhalflgrgdqypial
    egalklkeisyihaeayaagelkhgplalidadmpvivvapnnelleklksnieevrarg
    gqlyvfadqdagfvssdnmhiiemphveeviapifytvplqllayhvalikgtdvdqprn
    laksvtve
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jxaB (B:)
    cgivgaiaqrdvaeilleglrrleyrgydsaglavvdaeghmtrlrrlgkvqmlaqaaee
    hplhggtgiahtrwathgepsevnahphvsehivvvhngiienheplreelkargytfvs
    etdteviahlvnwelkqggtlreavlraipqlrgaygtvimdsrhpdtllaarsgsplvi
    glgmgenfiasdqlallpvtrrfifleegdiaeitrrsvnifdktgaevkrqdiesnlqy
    dagdkgiyrhymqkeiyeqpnaikntltgrishgqvdlselgpnadellskvehiqilac
    gtsynsgmvsrywfeslagipcdveiasefryrksavrrnslmitlsqsgetadtlaglr
    lskelgylgslaicnvpgsslvresdlalmtnagteigvastkafttqltvllmlvakls
    klkgldasiehdivhglqalpsrieqmlsqdkriealaedfsdkhhalflgrgdqypial
    egalklkeisyihaeayaagelkhgplalidadmpvivvapnnelleklksnieevrarg
    gqlyvfadqdagfvssdnmhiiemphveeviapifytvplqllayhvalikgtdvdqprn
    laksvtve
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jxaC (C:)
    cgivgaiaqrdvaeilleglrrleyrgydsaglavvdaeghmtrlrrlgkvqmlaqaaee
    hplhggtgiahtrwathgepsevnahphvsehivvvhngiienheplreelkargytfvs
    etdteviahlvnwelkqggtlreavlraipqlrgaygtvimdsrhpdtllaarsgsplvi
    glgmgenfiasdqlallpvtrrfifleegdiaeitrrsvnifdktgaevkrqdiesnlqy
    dagdkgiyrhymqkeiyeqpnaikntltgrishgqvdlselgpnadellskvehiqilac
    gtsynsgmvsrywfeslagipcdveiasefryrksavrrnslmitlsqsgetadtlaglr
    lskelgylgslaicnvpgsslvresdlalmtnagteigvastkafttqltvllmlvakls
    klkgldasiehdivhglqalpsrieqmlsqdkriealaedfsdkhhalflgrgdqypial
    egalklkeisyihaeayaagelkhgplalidadmpvivvapnnelleklksnieevrarg
    gqlyvfadqdagfvssdnmhiiemphveeviapifytvplqllayhvalikgtdvdqprn
    laksvtve