SCOP 1.59: Domain d1jvna2: 1jvn A:-3-229

Lineage for d1jvna2 (1jvn A:-3-229)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.23: Flavodoxin-like [52171] (17 superfamilies)

4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (4 families)

5. Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (4 proteins)

6. Protein GAT subunit (or domain) of imidazoleglycerolphosphate synthase HisF [69447] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae), His7 [TaxId:4932] [69449] (1 PDB entry)

8. Domain d1jvna2: 1jvn A:-3-229 [67356]
   Other proteins in same PDB: d1jvna1, d1jvnb1

Details for d1jvna2

PDB Entry: 1jvn, 2.1 Å

PDB Description: crystal structure of imidazole glycerol phosphate synthase: a tunnel through a (beta/alpha)8 barrel joins two active sites

SCOP Domain Sequences for d1jvna2:

Sequence; same for both SEQRES and ATOM records:

>d1jvna2 c.23.16.1 (A:-3-229) GAT subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Baker's yeast (Saccharomyces cerevisiae), His7}
gshmpvvhvidvesgnlqsltnaiehlgyevqlvkspkdfnisgtsrlilpgvgnyghfv
dnlfnrgfekpireyiesgkpimgicvglqalfagsvespkstglnyidfklsrfddsek
pvpeigwnscipsenlffgldpykryyfvhsfaailnsekkknlendgwkiakakygsee
fiaavnknnifatqfhpeksgkaglnvienflkqqsppipnysaeekellmn

Timeline for d1jvna2:

• d1jvna2 is new in SCOP 1.59
  
• d1jvna2 appears in SCOP 1.61
  
• d1jvna2 appears in the current release, SCOPe 2.08