Lineage for d1jvna1 (1jvn A:230-552)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 115904Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 116030Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (4 families) (S)
  5. 116031Family c.1.2.1: Histidine biosynthesis enzymes [51367] (2 proteins)
  6. 116032Protein Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF [51370] (3 species)
  7. 116036Species Baker's yeast (Saccharomyces cerevisiae), His7 [TaxId:4932] [69379] (1 PDB entry)
  8. 116037Domain d1jvna1: 1jvn A:230-552 [67355]
    Other proteins in same PDB: d1jvna2, d1jvnb2

Details for d1jvna1

PDB Entry: 1jvn (more details), 2.1 Å

PDB Description: crystal structure of imidazole glycerol phosphate synthase: a tunnel through a (beta/alpha)8 barrel joins two active sites
PDB Compounds: (A:)

SCOP Domain Sequences for d1jvna1:

Sequence, based on SEQRES records: (download)

>d1jvna1 c.1.2.1 (A:230-552) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Baker's yeast (Saccharomyces cerevisiae), His7}
dysnygltrriiacldvrtndqgdlvvtkgdqydvreksdgkgvrnlgkpvqlaqkyyqq
gadevtflnitsfrdcplkdtpmlevlkqaaktvfvpltvgggikdivdvdgtkipalev
aslyfrsgadkvsigtdavyaaekyyelgnrgdgtspietiskaygaqavvisvdpkrvy
vnsqadtknkvfeteypgpngekycwyqctikggresrdlgvweltracealgageilln
cidkdgsnsgydleliehvkdavkipviassgagvpehfeeaflktradaclgagmfhrg
eftvndvkeyllehglkvrmdee

Sequence, based on observed residues (ATOM records): (download)

>d1jvna1 c.1.2.1 (A:230-552) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Baker's yeast (Saccharomyces cerevisiae), His7}
dysnygltrriiacldvrtndqgdlvvtkgdlgkpvqlaqkyyqqgadevtflnitdcpl
kdtpmlevlkqaaktvfvpltvgggikdivdvdgtkipalevaslyfrsgadkvsigtda
vyaaekyyelgnrgdgtspietiskaygaqavvisvdpkrvyvnsqadtknkvfeteypg
pngekycwyqctikggresrdlgvweltracealgageillncidkdgsnsgydlelieh
vkdavkipviassgagvpehfeeaflktradaclgagmfhrgeftvndvkeyllehglkv
rmdee

SCOP Domain Coordinates for d1jvna1:

Click to download the PDB-style file with coordinates for d1jvna1.
(The format of our PDB-style files is described here.)

Timeline for d1jvna1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jvna2