Lineage for d1jvna2 (1jvn A:-3-229)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 177542Fold c.23: Flavodoxin-like [52171] (16 superfamilies)
  4. 178184Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (4 families) (S)
  5. 178185Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (5 proteins)
  6. 178240Protein GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF [69447] (2 species)
  7. 178241Species Baker's yeast (Saccharomyces cerevisiae), His7 [TaxId:4932] [69449] (1 PDB entry)
  8. 178242Domain d1jvna2: 1jvn A:-3-229 [67356]
    Other proteins in same PDB: d1jvna1, d1jvnb1

Details for d1jvna2

PDB Entry: 1jvn (more details), 2.1 Å

PDB Description: crystal structure of imidazole glycerol phosphate synthase: a tunnel through a (beta/alpha)8 barrel joins two active sites

SCOP Domain Sequences for d1jvna2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jvna2 c.23.16.1 (A:-3-229) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Baker's yeast (Saccharomyces cerevisiae), His7}
gshmpvvhvidvesgnlqsltnaiehlgyevqlvkspkdfnisgtsrlilpgvgnyghfv
dnlfnrgfekpireyiesgkpimgicvglqalfagsvespkstglnyidfklsrfddsek
pvpeigwnscipsenlffgldpykryyfvhsfaailnsekkknlendgwkiakakygsee
fiaavnknnifatqfhpeksgkaglnvienflkqqsppipnysaeekellmn

SCOP Domain Coordinates for d1jvna2:

Click to download the PDB-style file with coordinates for d1jvna2.
(The format of our PDB-style files is described here.)

Timeline for d1jvna2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jvna1