Lineage for d1jroe2 (1jro E:1-84)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2177211Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2179170Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 2179355Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins)
  6. 2179485Protein Xanthine dehydrogenase chain A, N-terminal domain [69666] (1 species)
  7. 2179486Species Rhodobacter capsulatus [TaxId:1061] [69667] (2 PDB entries)
  8. 2179489Domain d1jroe2: 1jro E:1-84 [67150]
    Other proteins in same PDB: d1jroa1, d1jroa3, d1jroa4, d1jrob1, d1jrob2, d1jroc1, d1jroc3, d1jroc4, d1jrod1, d1jrod2, d1jroe1, d1jroe3, d1jroe4, d1jrof1, d1jrof2, d1jrog1, d1jrog3, d1jrog4, d1jroh1, d1jroh2
    complexed with ca, fad, fes, mos, mte

Details for d1jroe2

PDB Entry: 1jro (more details), 2.7 Å

PDB Description: crystal structure of xanthine dehydrogenase from rhodobacter capsulatus
PDB Compounds: (E:) xanthine dehydrogenase, chain A

SCOPe Domain Sequences for d1jroe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jroe2 d.15.4.2 (E:1-84) Xanthine dehydrogenase chain A, N-terminal domain {Rhodobacter capsulatus [TaxId: 1061]}
meiafllngetrrvriedptqsllellraegltgtkegcnegdcgactvmirdaagsrav
naclmmlpqiagkalrtiegiaap

SCOPe Domain Coordinates for d1jroe2:

Click to download the PDB-style file with coordinates for d1jroe2.
(The format of our PDB-style files is described here.)

Timeline for d1jroe2: