Lineage for d1jrof1 (1jro F:2-123)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2188935Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 2188936Superfamily d.41.1: CO dehydrogenase molybdoprotein N-domain-like [54665] (2 families) (S)
  5. 2188937Family d.41.1.1: CO dehydrogenase molybdoprotein N-domain-like [54666] (6 proteins)
  6. 2188981Protein Xanthine dehydrogenase chain B, N-terminal domain [69691] (1 species)
  7. 2188982Species Rhodobacter capsulatus [TaxId:1061] [69692] (4 PDB entries)
  8. 2188989Domain d1jrof1: 1jro F:2-123 [67153]
    Other proteins in same PDB: d1jroa1, d1jroa2, d1jroa3, d1jroa4, d1jrob2, d1jroc1, d1jroc2, d1jroc3, d1jroc4, d1jrod2, d1jroe1, d1jroe2, d1jroe3, d1jroe4, d1jrof2, d1jrog1, d1jrog2, d1jrog3, d1jrog4, d1jroh2
    complexed with ca, fad, fes, mos, mte

Details for d1jrof1

PDB Entry: 1jro (more details), 2.7 Å

PDB Description: crystal structure of xanthine dehydrogenase from rhodobacter capsulatus
PDB Compounds: (F:) xanthine dehydrogenase, chain B

SCOPe Domain Sequences for d1jrof1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jrof1 d.41.1.1 (F:2-123) Xanthine dehydrogenase chain B, N-terminal domain {Rhodobacter capsulatus [TaxId: 1061]}
svgkplphdsarahvtgqarylddlpcpantlhlafglsteasaaitgldlepvrespgv
iavftaadlphdndaspapspepvlatgevhfvgqpiflvaatshraariaarkaritya
pr

SCOPe Domain Coordinates for d1jrof1:

Click to download the PDB-style file with coordinates for d1jrof1.
(The format of our PDB-style files is described here.)

Timeline for d1jrof1: