Lineage for d1jroc4 (1jro C:179-345)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2223741Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 2223742Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) (S)
  5. 2223838Family d.145.1.3: CO dehydrogenase flavoprotein N-terminal domain-like [56187] (6 proteins)
    automatically mapped to Pfam PF00941
  6. 2223868Protein Xanthine dehydrogenase chain A, domain 3 [69829] (1 species)
  7. 2223869Species Rhodobacter capsulatus [TaxId:1061] [69830] (2 PDB entries)
  8. 2223871Domain d1jroc4: 1jro C:179-345 [67146]
    Other proteins in same PDB: d1jroa1, d1jroa2, d1jroa3, d1jrob1, d1jrob2, d1jroc1, d1jroc2, d1jroc3, d1jrod1, d1jrod2, d1jroe1, d1jroe2, d1jroe3, d1jrof1, d1jrof2, d1jrog1, d1jrog2, d1jrog3, d1jroh1, d1jroh2
    complexed with ca, fad, fes, mos, mte

Details for d1jroc4

PDB Entry: 1jro (more details), 2.7 Å

PDB Description: crystal structure of xanthine dehydrogenase from rhodobacter capsulatus
PDB Compounds: (C:) xanthine dehydrogenase, chain A

SCOPe Domain Sequences for d1jroc4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jroc4 d.145.1.3 (C:179-345) Xanthine dehydrogenase chain A, domain 3 {Rhodobacter capsulatus [TaxId: 1061]}
paflpetsdaladwylahpeatliaggtdvslwvtkalrdlpevaflshckdlaqiretp
dgygigagvtiaalrafaegphpalagllrrfaseqvrqvatiggniangspigdgppal
iamgasltlrrgqerrrmpledffleyrkqdrrpgefvesvtlpksa

SCOPe Domain Coordinates for d1jroc4:

Click to download the PDB-style file with coordinates for d1jroc4.
(The format of our PDB-style files is described here.)

Timeline for d1jroc4: