SCOPe 2.06: Domain d1jn5a_: 1jn5 A:

Lineage for d1jn5a_ (1jn5 A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.2: NTF2-like [54431] (6 proteins)

6. Protein NTF2-related export protein 1 (p15) [69675] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69676] (2 PDB entries)

8. Domain d1jn5a_: 1jn5 A: [66921]
   Other proteins in same PDB: d1jn5b1, d1jn5b2

Details for d1jn5a_

PDB Entry: 1jn5, 2.8 Å

PDB Description: Structural basis for the recognition of a nucleoporin FG-repeat by the NTF2-like domain of TAP-p15 mRNA export factor

PDB Compounds: (A:) p15

SCOPe Domain Sequences for d1jn5a_:

Sequence; same for both SEQRES and ATOM records:

>d1jn5a_ d.17.4.2 (A:) NTF2-related export protein 1 (p15) {Human (Homo sapiens) [TaxId: 9606]}
vdfktyvdqacraaeefvnvyyttmdkrrrllsrlymgtatlvwngnavsgqeslseffe
mlpssefqisvvdcqpvhdeatpsqttvlvvicgsvkfegnkqrdfnqnfiltaqaspsn
tvwkiasdcfrfqdwa

Timeline for d1jn5a_:

• d1jn5a_ first appeared in SCOP 1.59
  
• d1jn5a_ appears in SCOPe 2.05
  
• d1jn5a_ appears in SCOPe 2.07
  
• d1jn5a_ appears in the current release, SCOPe 2.08