PDB entry 1jn5

View 1jn5 on RCSB PDB site
Description: Structural basis for the recognition of a nucleoporin FG-repeat by the NTF2-like domain of TAP-p15 mRNA export factor
Class: transport protein
Keywords: NTF2-like domain, nucleoporin, FG-repeat, TRANSPORT PROTEIN
Deposited on 2001-07-23, released 2001-10-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.241
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: p15
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1jn5a_
  • Chain 'B':
    Compound: tap
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UBU9 (1-End)
      • cloning artifact (0)
    Domains in SCOPe 2.06: d1jn5b1, d1jn5b2
  • Chain 'C':
    Compound: FG-repeat
    Species: synthetic, synthetic
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1JN5

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jn5A (A:)
    masvdfktyvdqacraaeefvnvyyttmdkrrrllsrlymgtatlvwngnavsgqeslse
    ffemlpssefqisvvdcqpvhdeatpsqttvlvvicgsvkfegnkqrdfnqnfiltaqas
    psntvwkiasdcfrfqdwas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jn5A (A:)
    vdfktyvdqacraaeefvnvyyttmdkrrrllsrlymgtatlvwngnavsgqeslseffe
    mlpssefqisvvdcqpvhdeatpsqttvlvvicgsvkfegnkqrdfnqnfiltaqaspsn
    tvwkiasdcfrfqdwa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jn5B (B:)
    appckgsyfgtenlkslvlhflqqyyaiydsgdrqglldayhdgaccslsipfipqnpar
    sslaeyfkdsrnvkklkdptlrfrllkhtrlnvvaflnelpktqhdvnsfvvdisaqtst
    llcfsvngvfkevdgksrdslraftrtfiavpasnsglcivndelfvrnasseeiqrafa
    mpaptpssspvptlspeqqemlqafstqsgmnlewsqkclqdnnwdytrsaqafthlkak
    geipevafmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jn5B (B:)
    appckgsyfgtenlkslvlhflqqyyaiydsgdrqglldayhdgaccslsipfiarssla
    eyfkdsrnvkklkdptlrfrllkhtrlnvvaflnelpktqhdvnsfvvdisaqtstllcf
    svngvfkevdgksrdslraftrtfiavpasnsglcivndelfvrnasseeiqrafampap
    tp
    

  • Chain 'C':
    No sequence available.