Lineage for d1jn5a_ (1jn5 A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1895674Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1896198Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 1896222Family d.17.4.2: NTF2-like [54431] (6 proteins)
  6. 1896240Protein NTF2-related export protein 1 (p15) [69675] (1 species)
  7. 1896241Species Human (Homo sapiens) [TaxId:9606] [69676] (2 PDB entries)
  8. 1896243Domain d1jn5a_: 1jn5 A: [66921]
    Other proteins in same PDB: d1jn5b_

Details for d1jn5a_

PDB Entry: 1jn5 (more details), 2.8 Å

PDB Description: Structural basis for the recognition of a nucleoporin FG-repeat by the NTF2-like domain of TAP-p15 mRNA export factor
PDB Compounds: (A:) p15

SCOPe Domain Sequences for d1jn5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jn5a_ d.17.4.2 (A:) NTF2-related export protein 1 (p15) {Human (Homo sapiens) [TaxId: 9606]}
vdfktyvdqacraaeefvnvyyttmdkrrrllsrlymgtatlvwngnavsgqeslseffe
mlpssefqisvvdcqpvhdeatpsqttvlvvicgsvkfegnkqrdfnqnfiltaqaspsn
tvwkiasdcfrfqdwa

SCOPe Domain Coordinates for d1jn5a_:

Click to download the PDB-style file with coordinates for d1jn5a_.
(The format of our PDB-style files is described here.)

Timeline for d1jn5a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1jn5b_