Lineage for d1jjid_ (1jji D:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1178944Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1178945Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1179308Family c.69.1.2: Carboxylesterase [53487] (7 proteins)
  6. 1179309Protein Carboxylesterase [53488] (3 species)
    bacterial homologue of human hormone sensitive lipase
  7. 1179315Species Archaeoglobus fulgidus [TaxId:2234] [69576] (1 PDB entry)
  8. 1179319Domain d1jjid_: 1jji D: [66769]
    complexed with epe

Details for d1jjid_

PDB Entry: 1jji (more details), 2.2 Å

PDB Description: The Crystal Structure of a Hyper-thermophilic Carboxylesterase from the Archaeon Archaeoglobus fulgidus
PDB Compounds: (D:) carboxylesterase

SCOPe Domain Sequences for d1jjid_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jjid_ c.69.1.2 (D:) Carboxylesterase {Archaeoglobus fulgidus [TaxId: 2234]}
mldmpidpvyyqlaeyfdslpkfdqfssareyreainriyeernrqlsqhervervedrt
ikgrngdirvrvyqqkpdspvlvyyhgggfvicsieshdalcrriarlsnstvvsvdyrl
apehkfpaavydcydatkwvaenaeelridpskifvggdsaggnlaaavsimardsgedf
ikhqiliypvvnfvaptpsllefgeglwildqkimswfseqyfsreedkfnplasvifad
lenlppaliitaeydplrdegevfgqmlrragveasivryrgvlhgfinyypvlkaarda
inqiaallvfd

SCOPe Domain Coordinates for d1jjid_:

Click to download the PDB-style file with coordinates for d1jjid_.
(The format of our PDB-style files is described here.)

Timeline for d1jjid_: