SCOPe 2.02: Domain d1jjib_: 1jji B:

Lineage for d1jjib_ (1jji B:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.2: Carboxylesterase [53487] (7 proteins)

6. Protein Carboxylesterase [53488] (3 species)
   bacterial homologue of human hormone sensitive lipase

7. Species Archaeoglobus fulgidus [TaxId:2234] [69576] (1 PDB entry)

8. Domain d1jjib_: 1jji B: [66767]
   complexed with epe

Details for d1jjib_

PDB Entry: 1jji, 2.2 Å

PDB Description: The Crystal Structure of a Hyper-thermophilic Carboxylesterase from the Archaeon Archaeoglobus fulgidus

PDB Compounds: (B:) carboxylesterase

SCOPe Domain Sequences for d1jjib_:

Sequence; same for both SEQRES and ATOM records:

>d1jjib_ c.69.1.2 (B:) Carboxylesterase {Archaeoglobus fulgidus [TaxId: 2234]}
mldmpidpvyyqlaeyfdslpkfdqfssareyreainriyeernrqlsqhervervedrt
ikgrngdirvrvyqqkpdspvlvyyhgggfvicsieshdalcrriarlsnstvvsvdyrl
apehkfpaavydcydatkwvaenaeelridpskifvggdsaggnlaaavsimardsgedf
ikhqiliypvvnfvaptpsllefgeglwildqkimswfseqyfsreedkfnplasvifad
lenlppaliitaeydplrdegevfgqmlrragveasivryrgvlhgfinyypvlkaarda
inqiaallvfd

Timeline for d1jjib_:

• d1jjib_ first appeared in SCOP 1.59
  
• d1jjib_ appears in SCOPe 2.01
  
• d1jjib_ appears in SCOPe 2.03
  
• d1jjib_ appears in the current release, SCOPe 2.08