Class b: All beta proteins [48724] (180 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) |
Family b.34.2.1: SH3-domain [50045] (40 proteins) |
Protein Carboxyl-terminal src kinase (csk) [74654] (2 species) |
Species Mouse (Mus musculus) [TaxId:10090] [74655] (1 PDB entry) |
Domain d1jega_: 1jeg A: [66610] complexed with peptide |
PDB Entry: 1jeg (more details)
SCOPe Domain Sequences for d1jega_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jega_ b.34.2.1 (A:) Carboxyl-terminal src kinase (csk) {Mouse (Mus musculus) [TaxId: 10090]} sgteciakynfhgtaeqdlpfckgdvltivavtkdpnwykaknkvgregiipanyvqkre
Timeline for d1jega_: