Lineage for d1jega_ (1jeg A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2782861Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2782862Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2782984Protein Carboxyl-terminal src kinase (csk) [74654] (2 species)
  7. 2782996Species Mouse (Mus musculus) [TaxId:10090] [74655] (1 PDB entry)
  8. 2782997Domain d1jega_: 1jeg A: [66610]
    complexed with peptide

Details for d1jega_

PDB Entry: 1jeg (more details)

PDB Description: solution structure of the sh3 domain from c-terminal src kinase complexed with a peptide from the tyrosine phosphatase pep
PDB Compounds: (A:) Tyrosine-protein kinase CSK

SCOPe Domain Sequences for d1jega_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jega_ b.34.2.1 (A:) Carboxyl-terminal src kinase (csk) {Mouse (Mus musculus) [TaxId: 10090]}
sgteciakynfhgtaeqdlpfckgdvltivavtkdpnwykaknkvgregiipanyvqkre

SCOPe Domain Coordinates for d1jega_:

Click to download the PDB-style file with coordinates for d1jega_.
(The format of our PDB-style files is described here.)

Timeline for d1jega_: