PDB entry 1jeg

View 1jeg on RCSB PDB site
Description: Solution structure of the SH3 domain from C-terminal Src Kinase complexed with a peptide from the tyrosine phosphatase PEP
Class: transferase/hydrolase
Keywords: SH3 domain, protein-peptide complex, tyrosine phosphatase, kinase, TRANSFERASE/HYDROLASE COMPLEX
Deposited on 2001-06-17, released 2001-10-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase CSK
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jega_
  • Chain 'B':
    Compound: hematopoietic cell protein-tyrosine phosphatase 70z-pep
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jegA (A:)
    msaiqaawpsgteciakynfhgtaeqdlpfckgdvltivavtkdpnwykaknkvgregii
    panyvqkregvkagtklslmpwf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jegA (A:)
    sgteciakynfhgtaeqdlpfckgdvltivavtkdpnwykaknkvgregiipanyvqkre
    

  • Chain 'B':
    No sequence available.