Lineage for d1jega_ (1jeg A:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 109314Fold b.34: SH3-like barrel [50036] (9 superfamilies)
  4. 109356Superfamily b.34.2: SH3-domain [50044] (1 family) (S)
  5. 109357Family b.34.2.1: SH3-domain [50045] (20 proteins)
  6. 109398Protein c-src tyrosine kinase [50064] (4 species)
  7. 109420Species Mouse (Mus musculus) [TaxId:10090] [69245] (1 PDB entry)
  8. 109421Domain d1jega_: 1jeg A: [66610]

Details for d1jega_

PDB Entry: 1jeg (more details)

PDB Description: solution structure of the sh3 domain from c-terminal src kinase complexed with a peptide from the tyrosine phosphatase pep

SCOP Domain Sequences for d1jega_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jega_ b.34.2.1 (A:) c-src tyrosine kinase {Mouse (Mus musculus)}
sgteciakynfhgtaeqdlpfckgdvltivavtkdpnwykaknkvgregiipanyvqkre

SCOP Domain Coordinates for d1jega_:

Click to download the PDB-style file with coordinates for d1jega_.
(The format of our PDB-style files is described here.)

Timeline for d1jega_: