SCOP 1.73: Domain d1id3c_: 1id3 C:

Lineage for d1id3c_ (1id3 C:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (4 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (5 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein Histone H2A [47115] (5 species)

7. Species Baker's yeast (Saccharomyces cerevisiae), H2A.1 [TaxId:4932] [68984] (1 PDB entry)

8. Domain d1id3c_: 1id3 C: [66114]
   Other proteins in same PDB: d1id3a_, d1id3b_, d1id3d_, d1id3e_, d1id3f_, d1id3h_

Details for d1id3c_

PDB Entry: 1id3, 3.1 Å

PDB Description: crystal structure of the yeast nucleosome core particle reveals fundamental differences in inter-nucleosome interactions

PDB Compounds: (C:) histone h2a.1

SCOP Domain Sequences for d1id3c_:

Sequence; same for both SEQRES and ATOM records:

>d1id3c_ a.22.1.1 (C:) Histone H2A {Baker's yeast (Saccharomyces cerevisiae), H2A.1 [TaxId: 4932]}
qsrsakagltfpvgrvhrllrrgnyaqrigsgapvyltavleylaaeilelagnaardnk
ktriiprhlqlairnddelnkllgnvtiaqggvlpnihqnllpkksakat

Timeline for d1id3c_:

• d1id3c_ first appeared in SCOP 1.59
  
• d1id3c_ appears in SCOP 1.71
  
• d1id3c_ appears in SCOP 1.75
  
• d1id3c_ appears in the current release, SCOPe 2.08