Lineage for d1id3f_ (1id3 F:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 637441Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 637442Superfamily a.22.1: Histone-fold [47113] (4 families) (S)
  5. 637443Family a.22.1.1: Nucleosome core histones [47114] (5 proteins)
    form octamers composed of two copies of each of the four histones
  6. 637645Protein Histone H4 [47125] (4 species)
  7. 637701Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [68987] (1 PDB entry)
  8. 637703Domain d1id3f_: 1id3 F: [66117]
    Other proteins in same PDB: d1id3a_, d1id3c_, d1id3d_, d1id3e_, d1id3g_, d1id3h_
    complexed with mn

Details for d1id3f_

PDB Entry: 1id3 (more details), 3.1 Å

PDB Description: crystal structure of the yeast nucleosome core particle reveals fundamental differences in inter-nucleosome interactions
PDB Compounds: (F:) histone h4

SCOP Domain Sequences for d1id3f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1id3f_ a.22.1.1 (F:) Histone H4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
hrkilrdniqgitkpairrlarrggvkrisgliyeevravlksflesvirdsvtytehak
rktvtsldvvyalkrqgrtlygfgg

SCOP Domain Coordinates for d1id3f_:

Click to download the PDB-style file with coordinates for d1id3f_.
(The format of our PDB-style files is described here.)

Timeline for d1id3f_: