![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) ![]() dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
![]() | Family d.58.4.2: Lrp/AsnC-like transcriptional regulator C-terminal domain [69733] (5 proteins) octamer: tetramer of dimers automatically mapped to Pfam PF01037 |
![]() | Protein LprA [69734] (1 species) |
![]() | Species Pyrococcus furiosus [TaxId:2261] [69735] (1 PDB entry) |
![]() | Domain d1i1ga2: 1i1g A:62-141 [65983] Other proteins in same PDB: d1i1ga1, d1i1gb1 |
PDB Entry: 1i1g (more details), 2.9 Å
SCOPe Domain Sequences for d1i1ga2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i1ga2 d.58.4.2 (A:62-141) LprA {Pyrococcus furiosus [TaxId: 2261]} yslvtitgvdtkpeklfevaeklkeydfvkelylssgdhmimaviwakdgedlaeiisnk igkiegvtkvcpaiileklk
Timeline for d1i1ga2: