Lineage for d1i1ga2 (1i1g A:62-141)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2556580Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 2556594Family d.58.4.2: Lrp/AsnC-like transcriptional regulator C-terminal domain [69733] (5 proteins)
    octamer: tetramer of dimers
    automatically mapped to Pfam PF01037
  6. 2556595Protein LprA [69734] (1 species)
  7. 2556596Species Pyrococcus furiosus [TaxId:2261] [69735] (1 PDB entry)
  8. 2556597Domain d1i1ga2: 1i1g A:62-141 [65983]
    Other proteins in same PDB: d1i1ga1, d1i1gb1

Details for d1i1ga2

PDB Entry: 1i1g (more details), 2.9 Å

PDB Description: crystal structure of the lrp-like transcriptional regulator from the archaeon pyrococcus furiosus
PDB Compounds: (A:) transcriptional regulator lrpa

SCOPe Domain Sequences for d1i1ga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i1ga2 d.58.4.2 (A:62-141) LprA {Pyrococcus furiosus [TaxId: 2261]}
yslvtitgvdtkpeklfevaeklkeydfvkelylssgdhmimaviwakdgedlaeiisnk
igkiegvtkvcpaiileklk

SCOPe Domain Coordinates for d1i1ga2:

Click to download the PDB-style file with coordinates for d1i1ga2.
(The format of our PDB-style files is described here.)

Timeline for d1i1ga2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1i1ga1