![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.32: Lrp/AsnC-like transcriptional regulator N-terminal domain [68967] (4 proteins) Swapped dimer with the "wing" C-terminal strands automatically mapped to Pfam PF13412 |
![]() | Protein LprA [68968] (1 species) |
![]() | Species Pyrococcus furiosus [TaxId:2261] [68969] (1 PDB entry) |
![]() | Domain d1i1gb1: 1i1g B:2-61 [65984] Other proteins in same PDB: d1i1ga2, d1i1gb2 |
PDB Entry: 1i1g (more details), 2.9 Å
SCOPe Domain Sequences for d1i1gb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i1gb1 a.4.5.32 (B:2-61) LprA {Pyrococcus furiosus [TaxId: 2261]} iderdkiileilekdartpfteiakklgisetavrkrvkaleekgiiegytikinpkklg
Timeline for d1i1gb1: