![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.1: Homeodomain-like [46689] (21 families) ![]() consists only of helices |
![]() | Family a.4.1.7: Centromere-binding [46756] (2 proteins) duplication: tandem repeat of two similar domains |
![]() | Protein DNA-binding domain of centromere binding protein B (CENP-B) [46757] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [46758] (2 PDB entries) |
![]() | Domain d1hlva1: 1hlv A:1-66 [65854] Other proteins in same PDB: d1hlva3 protein/DNA complex |
PDB Entry: 1hlv (more details), 2.5 Å
SCOPe Domain Sequences for d1hlva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hlva1 a.4.1.7 (A:1-66) DNA-binding domain of centromere binding protein B (CENP-B) {Human (Homo sapiens) [TaxId: 9606]} mgpkrrqltfreksriiqeveenpdlrkgeiarrfnippstlstilknkrailaserkyg vastcr
Timeline for d1hlva1: