Lineage for d1h8la2 (1h8l A:4-304)
- Root: SCOP 1.59
Class c: Alpha and beta proteins (a/b) [51349] (113 folds) 
Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies) 
Superfamily c.56.5: Zn-dependent exopeptidases [53187] (5 families) 
Family c.56.5.1: Pancreatic carboxypeptidases [53188] (3 proteins) 
Protein Carboxypeptidase D, catalytic domain [53196] (1 species) Species Crested duck (Lophonetta specularioides) [TaxId:8836] [53197] (2 PDB entries) 
Domain d1h8la2: 1h8l A:4-304 [65738]
Other proteins in same PDB: d1h8la1
Details for d1h8la2
PDB Entry: 1h8l (more details), 2.6 Å
PDB Description: duck carboxypeptidase d domain ii in complex with gemsa
SCOP Domain Sequences for d1h8la2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h8la2 c.56.5.1 (A:4-304) Carboxypeptidase D, catalytic domain {Crested duck (Lophonetta specularioides)}
qavqpvdfrhhhfsdmeiflrryaneypsitrlysvgksvelrelyvmeisdnpgiheag
epefkyignmhgnevvgrelllnlieylcknfgtdpevtdlvqstrihimpsmnpdgyek
sqegdrggtvgrnnsnnydlnrnfpdqffqvtdppqpetlavmswlktypfvlsanlhgg
slvvnypfdddeqgiaiyskspddavfqqlalsyskenkkmyqgspckdlypteyfphgi
tngaqwynvpggmqdwnylntncfevtielgcvkypkaeelpkyweqnrrsllqfikqvh
r
SCOP Domain Coordinates for d1h8la2:
Click to download the PDB-style file with coordinates for d1h8la2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1h8la2:
- d1h8la2 is new in SCOP 1.59
- d1h8la2 appears in SCOP 1.61
- d1h8la2 appears in the current release, SCOPe 2.08
View in 3D
