Lineage for d1h8la1 (1h8l A:305-383)
- Root: SCOP 1.59
Class b: All beta proteins [48724] (110 folds) 
Fold b.3: Prealbumin-like [49451] (6 superfamilies) 
Superfamily b.3.2: Carboxypeptidase D, a regulatory domain [49464] (1 family) 
Family b.3.2.1: Carboxypeptidase D, a regulatory domain [49465] (1 protein) Protein Carboxypeptidase D, a regulatory domain [49466] (1 species) Species Crested duck (Lophonetta specularioides) [TaxId:8836] [49467] (2 PDB entries) 
Domain d1h8la1: 1h8l A:305-383 [65737]
Other proteins in same PDB: d1h8la2
Details for d1h8la1
PDB Entry: 1h8l (more details), 2.6 Å
PDB Description: duck carboxypeptidase d domain ii in complex with gemsa
SCOP Domain Sequences for d1h8la1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h8la1 b.3.2.1 (A:305-383) Carboxypeptidase D, a regulatory domain {Crested duck (Lophonetta specularioides)}
giwgfvldatdgrgilnatisvadinhpvttykdgdywrllvqgtykvtasargydpvtk
tvevdskggvqvnftlsrt
SCOP Domain Coordinates for d1h8la1:
Click to download the PDB-style file with coordinates for d1h8la1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1h8la1:
- d1h8la1 is new in SCOP 1.59
- d1h8la1 appears in SCOP 1.61
- d1h8la1 appears in the current release, SCOPe 2.08
View in 3D
