SCOPe 2.08: Domain d1h8la2: 1h8l A:4-304

Lineage for d1h8la2 (1h8l A:4-304)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families)
   core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest

5. Family c.56.5.1: Pancreatic carboxypeptidases [53188] (5 proteins)

6. Protein Carboxypeptidase D, catalytic domain [53196] (1 species)

7. Species Crested duck (Lophonetta specularioides) [TaxId:8836] [53197] (2 PDB entries)

8. Domain d1h8la2: 1h8l A:4-304 [65738]
   Other proteins in same PDB: d1h8la1
   complexed with gem, nag, so4, zn

Details for d1h8la2

PDB Entry: 1h8l, 2.6 Å

PDB Description: duck carboxypeptidase d domain ii in complex with gemsa

PDB Compounds: (A:) carboxypeptidase gp180 residues 503-882

SCOPe Domain Sequences for d1h8la2:

Sequence; same for both SEQRES and ATOM records:

>d1h8la2 c.56.5.1 (A:4-304) Carboxypeptidase D, catalytic domain {Crested duck (Lophonetta specularioides) [TaxId: 8836]}
qavqpvdfrhhhfsdmeiflrryaneypsitrlysvgksvelrelyvmeisdnpgiheag
epefkyignmhgnevvgrelllnlieylcknfgtdpevtdlvqstrihimpsmnpdgyek
sqegdrggtvgrnnsnnydlnrnfpdqffqvtdppqpetlavmswlktypfvlsanlhgg
slvvnypfdddeqgiaiyskspddavfqqlalsyskenkkmyqgspckdlypteyfphgi
tngaqwynvpggmqdwnylntncfevtielgcvkypkaeelpkyweqnrrsllqfikqvh
r

Timeline for d1h8la2:

• d1h8la2 first appeared in SCOP 1.59
  
• d1h8la2 appears in SCOPe 2.07