| Class h: Coiled coil proteins [57942] (6 folds) |
| Fold h.1: Parallel coiled-coil [57943] (22 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.3: Leucine zipper domain [57959] (1 family) ![]() |
| Family h.1.3.1: Leucine zipper domain [57960] (13 proteins) |
| Protein C/ebp beta [57985] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [64590] (5 PDB entries) |
| Domain d1h89a_: 1h89 A: [65724] Other proteins in same PDB: d1h89c1, d1h89c2, d1h89c3 |
PDB Entry: 1h89 (more details), 2.45 Å
SCOP Domain Sequences for d1h89a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h89a_ h.1.3.1 (A:) C/ebp beta {Human (Homo sapiens)}
eykirrernniavrksrdkakmrnletqhkvleltaenerlqkkveqlsrelstlrnlfk
qlpe
Timeline for d1h89a_:
View in 3DDomains from other chains: (mouse over for more information) d1h89b_, d1h89c1, d1h89c2, d1h89c3 |