Lineage for d1h89b_ (1h89 B:)

  1. Root: SCOP 1.63
  2. 271841Class h: Coiled coil proteins [57942] (6 folds)
  3. 271842Fold h.1: Parallel coiled-coil [57943] (22 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 271981Superfamily h.1.3: Leucine zipper domain [57959] (1 family) (S)
  5. 271982Family h.1.3.1: Leucine zipper domain [57960] (13 proteins)
  6. 272002Protein C/ebp beta [57985] (2 species)
  7. 272003Species Human (Homo sapiens) [TaxId:9606] [64590] (5 PDB entries)
  8. 272015Domain d1h89b_: 1h89 B: [65725]
    Other proteins in same PDB: d1h89c1, d1h89c2, d1h89c3
    complexed with k; mutant

Details for d1h89b_

PDB Entry: 1h89 (more details), 2.45 Å

PDB Description: crystal structure of ternary protein-dna complex2

SCOP Domain Sequences for d1h89b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h89b_ h.1.3.1 (B:) C/ebp beta {Human (Homo sapiens)}
eykirrernniavrksrdkakmrnletqhkvleltaenerlqkkveqlsrelstlrnlfk
qlpe

SCOP Domain Coordinates for d1h89b_:

Click to download the PDB-style file with coordinates for d1h89b_.
(The format of our PDB-style files is described here.)

Timeline for d1h89b_: