Lineage for d1h89a_ (1h89 A:)

  1. Root: SCOP 1.65
  2. 344849Class h: Coiled coil proteins [57942] (6 folds)
  3. 344850Fold h.1: Parallel coiled-coil [57943] (26 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 344989Superfamily h.1.3: Leucine zipper domain [57959] (1 family) (S)
  5. 344990Family h.1.3.1: Leucine zipper domain [57960] (14 proteins)
  6. 345016Protein C/ebp beta [57985] (2 species)
  7. 345017Species Human (Homo sapiens) [TaxId:9606] [64590] (7 PDB entries)
  8. 345032Domain d1h89a_: 1h89 A: [65724]
    Other proteins in same PDB: d1h89c1, d1h89c2, d1h89c3

Details for d1h89a_

PDB Entry: 1h89 (more details), 2.45 Å

PDB Description: crystal structure of ternary protein-dna complex2

SCOP Domain Sequences for d1h89a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h89a_ h.1.3.1 (A:) C/ebp beta {Human (Homo sapiens)}
eykirrernniavrksrdkakmrnletqhkvleltaenerlqkkveqlsrelstlrnlfk
qlpe

SCOP Domain Coordinates for d1h89a_:

Click to download the PDB-style file with coordinates for d1h89a_.
(The format of our PDB-style files is described here.)

Timeline for d1h89a_: