SCOPe 2.08: Domain d1h6rb1: 1h6r B:2-231

Lineage for d1h6rb1 (1h6r B:2-231)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)

6. Protein Green fluorescent protein, GFP [54513] (6 species)

7. Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (285 PDB entries)
   Uniprot P42212

8. Domain d1h6rb1: 1h6r B:2-231 [65684]
   Other proteins in same PDB: d1h6ra2, d1h6rb2, d1h6rc2
   a redox sensitive variant
   complexed with cl

Details for d1h6rb1

PDB Entry: 1h6r, 1.5 Å

PDB Description: the oxidized state of a redox sensitive variant of green fluorescent protein

PDB Compounds: (B:) Green fluorescent protein

SCOPe Domain Sequences for d1h6rb1:

Sequence; same for both SEQRES and ATOM records:

>d1h6rb1 d.22.1.1 (B:2-231) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria) [TaxId: 6100]}
skgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkfivttgklpvpwptlv
ttfxlqcfarypdhmkrhdffksampegyvqertiffkddgnyktraevkfegdtlvnri
elkgidfkedgnilghkleynynshcvyivadkqkngikvnfkirhniedgsvqladhyq
qntpigdgpvllpdnhylcyqsalskdpnekrdhmvllefvtaagith

Timeline for d1h6rb1:

• d1h6rb1 first appeared in SCOP 1.59, called d1h6rb_
  
• d1h6rb1 appears in SCOPe 2.07