![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
![]() | Superfamily d.22.1: GFP-like [54511] (3 families) ![]() |
![]() | Family d.22.1.1: Fluorescent proteins [54512] (6 proteins) |
![]() | Protein Green fluorescent protein, GFP [54513] (6 species) |
![]() | Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (285 PDB entries) Uniprot P42212 |
![]() | Domain d1h6rb1: 1h6r B:2-231 [65684] Other proteins in same PDB: d1h6ra2, d1h6rb2, d1h6rc2 a redox sensitive variant complexed with cl |
PDB Entry: 1h6r (more details), 1.5 Å
SCOPe Domain Sequences for d1h6rb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h6rb1 d.22.1.1 (B:2-231) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria) [TaxId: 6100]} skgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkfivttgklpvpwptlv ttfxlqcfarypdhmkrhdffksampegyvqertiffkddgnyktraevkfegdtlvnri elkgidfkedgnilghkleynynshcvyivadkqkngikvnfkirhniedgsvqladhyq qntpigdgpvllpdnhylcyqsalskdpnekrdhmvllefvtaagith
Timeline for d1h6rb1:
![]() Domains from other chains: (mouse over for more information) d1h6ra1, d1h6ra2, d1h6rc1, d1h6rc2 |