![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
![]() | Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) ![]() there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
![]() | Family c.36.1.6: TK-like Pyr module [88735] (2 proteins) different order of the modules, PP module is N-terminal, Pyr module is next to it followed by a Rossmann-like domain |
![]() | Protein Transketolase (TK), Pyr module [88736] (4 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [88737] (7 PDB entries) |
![]() | Domain d1gpua2: 1gpu A:338-534 [65455] Other proteins in same PDB: d1gpua1, d1gpua3, d1gpub1, d1gpub3 complexed with ca, thd |
PDB Entry: 1gpu (more details), 1.86 Å
SCOPe Domain Sequences for d1gpua2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gpua2 c.36.1.6 (A:338-534) Transketolase (TK), Pyr module {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} lpanwesklptytakdsavatrklsetvledvynqlpeliggsadltpsnltrwkealdf qppssgsgnysgryirygirehamgaimngisafganykpyggtflnfvsyaagavrlsa lsghpviwvathdsigvgedgpthqpietlahfrslpniqvwrpadgnevsaayknsles khtpsiialsrqnlpql
Timeline for d1gpua2: