PDB entry 1gpu

View 1gpu on RCSB PDB site
Description: Transketolase intermediate
Class: transferase
Keywords: transferase(ketone residues), transferase
Deposited on 2001-11-09, released 2002-02-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-08-01, with a file datestamp of 2012-07-27.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: 0.198
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transketolase 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gpua1, d1gpua2, d1gpua3
  • Chain 'B':
    Compound: Transketolase 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gpub1, d1gpub2, d1gpub3
  • Heterogens: CA, THD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gpuA (A:)
    mtqftdidklavstirilavdtvskansghpgaplgmapaahvlwsqmrmnptnpdwinr
    drfvlsnghavallysmlhltgydlsiedlkqfrqlgsrtpghpefelpgvevttgplgq
    gisnavgmamaqanlaatynkpgftlsdnytyvflgdgclqegisseasslaghlklgnl
    iaiyddnkitidgatsisfdedvakryeaygwevlyvengnedlagiakaiaqaklskdk
    ptlikmtttigygslhagshsvhgaplkaddvkqlkskfgfnpdksfvvpqevydhyqkt
    ilkpgveannkwnklfseyqkkfpelgaelarrlsgqlpanwesklptytakdsavatrk
    lsetvledvynqlpeliggsadltpsnltrwkealdfqppssgsgnysgryirygireha
    mgaimngisafganykpyggtflnfvsyaagavrlsalsghpviwvathdsigvgedgpt
    hqpietlahfrslpniqvwrpadgnevsaayknsleskhtpsiialsrqnlpqlegssie
    saskggyvlqdvanpdiilvatgsevslsveaaktlaaknikarvvslpdfftfdkqple
    yrlsvlpdnvpimsvevlattcwgkyahqsfgidrfgasgkapevfkffgftpegvaera
    qktiafykgdklisplkkaf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gpuA (A:)
    qftdidklavstirilavdtvskansghpgaplgmapaahvlwsqmrmnptnpdwinrdr
    fvlsnghavallysmlhltgydlsiedlkqfrqlgsrtpghpefelpgvevttgplgqgi
    snavgmamaqanlaatynkpgftlsdnytyvflgdgclqegisseasslaghlklgnlia
    iyddnkitidgatsisfdedvakryeaygwevlyvengnedlagiakaiaqaklskdkpt
    likmtttigygslhagshsvhgaplkaddvkqlkskfgfnpdksfvvpqevydhyqktil
    kpgveannkwnklfseyqkkfpelgaelarrlsgqlpanwesklptytakdsavatrkls
    etvledvynqlpeliggsadltpsnltrwkealdfqppssgsgnysgryirygirehamg
    aimngisafganykpyggtflnfvsyaagavrlsalsghpviwvathdsigvgedgpthq
    pietlahfrslpniqvwrpadgnevsaayknsleskhtpsiialsrqnlpqlegssiesa
    skggyvlqdvanpdiilvatgsevslsveaaktlaaknikarvvslpdfftfdkqpleyr
    lsvlpdnvpimsvevlattcwgkyahqsfgidrfgasgkapevfkffgftpegvaeraqk
    tiafykgdklisplkkaf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1gpuB (B:)
    mtqftdidklavstirilavdtvskansghpgaplgmapaahvlwsqmrmnptnpdwinr
    drfvlsnghavallysmlhltgydlsiedlkqfrqlgsrtpghpefelpgvevttgplgq
    gisnavgmamaqanlaatynkpgftlsdnytyvflgdgclqegisseasslaghlklgnl
    iaiyddnkitidgatsisfdedvakryeaygwevlyvengnedlagiakaiaqaklskdk
    ptlikmtttigygslhagshsvhgaplkaddvkqlkskfgfnpdksfvvpqevydhyqkt
    ilkpgveannkwnklfseyqkkfpelgaelarrlsgqlpanwesklptytakdsavatrk
    lsetvledvynqlpeliggsadltpsnltrwkealdfqppssgsgnysgryirygireha
    mgaimngisafganykpyggtflnfvsyaagavrlsalsghpviwvathdsigvgedgpt
    hqpietlahfrslpniqvwrpadgnevsaayknsleskhtpsiialsrqnlpqlegssie
    saskggyvlqdvanpdiilvatgsevslsveaaktlaaknikarvvslpdfftfdkqple
    yrlsvlpdnvpimsvevlattcwgkyahqsfgidrfgasgkapevfkffgftpegvaera
    qktiafykgdklisplkkaf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gpuB (B:)
    qftdidklavstirilavdtvskansghpgaplgmapaahvlwsqmrmnptnpdwinrdr
    fvlsnghavallysmlhltgydlsiedlkqfrqlgsrtpghpefelpgvevttgplgqgi
    snavgmamaqanlaatynkpgftlsdnytyvflgdgclqegisseasslaghlklgnlia
    iyddnkitidgatsisfdedvakryeaygwevlyvengnedlagiakaiaqaklskdkpt
    likmtttigygslhagshsvhgaplkaddvkqlkskfgfnpdksfvvpqevydhyqktil
    kpgveannkwnklfseyqkkfpelgaelarrlsgqlpanwesklptytakdsavatrkls
    etvledvynqlpeliggsadltpsnltrwkealdfqppssgsgnysgryirygirehamg
    aimngisafganykpyggtflnfvsyaagavrlsalsghpviwvathdsigvgedgpthq
    pietlahfrslpniqvwrpadgnevsaayknsleskhtpsiialsrqnlpqlegssiesa
    skggyvlqdvanpdiilvatgsevslsveaaktlaaknikarvvslpdfftfdkqpleyr
    lsvlpdnvpimsvevlattcwgkyahqsfgidrfgasgkapevfkffgftpegvaeraqk
    tiafykgdklisplkkaf